BLASTX 2.2.9 [May-01-2004] BLASTX 2.2.9 [May-01-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NX0AMYA3YC22CM1.SCF (idq=208218) (967 letters) Database: /home/amadoui/banque/plasm_falciparum 5411 sequences; 4,065,673 total letters Searching...........done Score E Sequences producing significant alignments: (bits) Value Plasmodium_falciparum_3D7|MAL13|PF13_0298|Pf Annotation|Plasmodi... 28 3.1 Plasmodium_falciparum_3D7|MAL6|PFF0200c|Pf Annotation|Plasmodium... 27 7.0 Plasmodium_falciparum_3D7|MAL7|PF07_0086|Pf Annotation|Plasmodiu... 27 7.0 >Plasmodium_falciparum_3D7|MAL13|PF13_0298|Pf Annotation|Plasmodium_falciparum_Sanger|(protein coding) hypothetical protein Length = 1398 Score = 28.1 bits (61), Expect = 3.1 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 415 QVSVGNVGVLCLDSFEFFNHNDQTMVATVIDFRV 314 Q + N LCL+ F N++T ++ IDF++ Sbjct: 483 QEYINNYSKLCLEDKSLFYTNNETKISFTIDFKI 516 >Plasmodium_falciparum_3D7|MAL6|PFF0200c|Pf Annotation|Plasmodium_falciparum_Sanger|(protein coding) hypothetical protein Length = 1979 Score = 26.9 bits (58), Expect = 7.0 Identities = 14/50 (28%), Positives = 27/50 (54%) Frame = -2 Query: 831 HKRAMSAGSIIKSPVGSSYCSGPSHFLIVHLFSINSRKYSLENVVSARVH 682 +++ + + SI K+ GSS + + HL+ + KY+ +NVV+ H Sbjct: 1825 NEKTIHSNSIYKNCNGSSDDANVPYENSDHLYFMEKEKYASDNVVNRNAH 1874 >Plasmodium_falciparum_3D7|MAL7|PF07_0086|Pf Annotation|Plasmodium_falciparum_Sanger|(protein coding) hypothetical protein Length = 3429 Score = 26.9 bits (58), Expect = 7.0 Identities = 14/54 (25%), Positives = 25/54 (46%) Frame = +2 Query: 401 TYADLYVYAGVVAISEMGGPEVPFHLGRKDAKSGKESTPDDRLPDADKGSKPKT 562 TY DL+++ + S+ G + H G + K T + + D+G K +T Sbjct: 1341 TYYDLFLFFCTLLTSKGGDEIIKGHKGIIPTQGDKNETDEGNKNETDEGDKNET 1394 Database: /home/amadoui/banque/plasm_falciparum Posted date: Mar 30, 2007 3:37 PM Number of letters in database: 4,065,673 Number of sequences in database: 5411 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,222,826 Number of Sequences: 5411 Number of extensions: 127639 Number of successful extensions: 335 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 335 length of database: 4,065,673 effective HSP length: 93 effective length of database: 3,562,450 effective search space used: 812238600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)