BLASTX 2.2.9 [May-01-2004] BLASTX 2.2.9 [May-01-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Contig1160 NX0AINT3YA24CM1.SCF NX0AINT26YO23CM1.SCF NX0AINT22YN24CM1.SCF (985 letters) Database: /home/amadoui/banque/plasm_falciparum 5411 sequences; 4,065,673 total letters Searching...........done Score E Sequences producing significant alignments: (bits) Value Plasmodium_falciparum_3D7|MAL11|PF11_0302|Pf Annotation|Plasmodi... 36 0.012 Plasmodium_falciparum_3D7|MAL4|PFD0265w|Pf Annotation|Plasmodium... 28 2.5 Plasmodium_falciparum_3D7|MAL2|PFB0615c|Pf Annotation|Plasmodium... 28 4.2 Plasmodium_falciparum_3D7|MAL6|PFF0935c|Pf Annotation|Plasmodium... 28 4.2 Plasmodium_falciparum_3D7|MAL12|PFL1715w|Pf Annotation|Plasmodiu... 27 5.5 Plasmodium_falciparum_3D7|MAL5|PFE0870w|Pf Annotation|Plasmodium... 27 5.5 Plasmodium_falciparum_3D7|MAL13|PF13_0010|Pf Annotation|Plasmodi... 27 7.1 Plasmodium_falciparum_3D7|MAL10|PF10_0323|Pf Annotation|Plasmodi... 27 7.1 Plasmodium_falciparum_3D7|MAL11|PF11_0086|Pf Annotation|Plasmodi... 27 7.1 >Plasmodium_falciparum_3D7|MAL11|PF11_0302|Pf Annotation|Plasmodium_falciparum_TIGR|(protein coding) hypothetical protein Length = 452 Score = 36.2 bits (82), Expect = 0.012 Identities = 38/166 (22%), Positives = 58/166 (34%) Frame = +1 Query: 442 MTQAQAEQHLAQGFNPFDVTKVWSHKTYPLKEVGKLVLNRNPANYFSDVEQLAFSPAHFV 621 M + Q GFNPF K+ + L + L+LN N + + +Q + V Sbjct: 172 MNIEEISQEFFSGFNPFGTMKIRKEQNPDLSQKDSLILNENNNDSLTSADQ---KNNNMV 228 Query: 622 PGIQPSPDKMLQGRLFSYSDTHRHRLGPNYQQIPVNQPVQSQPKNYQRDGFMTVNGNQGG 801 P ++ R FSYS H + + V Q Q N Q D Sbjct: 229 P---------MENRSFSYSQQSSHVVSFDGHDEHVEQQEQHSGDNTQED----------- 268 Query: 802 APNYFPNSFNGPDYLAHVPDPAKQVSQTVIPSLSSKDENNFTQAGQ 939 D L +P +V T + +++ E N T+A Q Sbjct: 269 -----------KDQLMDLPFNKDKVFSTFLKNVTLLIEGNCTEAQQ 303 >Plasmodium_falciparum_3D7|MAL4|PFD0265w|Pf Annotation|Plasmodium_falciparum_Sanger|(protein coding) pre-mRNA splicing factor, putative Length = 3137 Score = 28.5 bits (62), Expect = 2.5 Identities = 22/80 (27%), Positives = 32/80 (40%), Gaps = 1/80 (1%) Frame = +1 Query: 685 HRHRLGPNYQQIPVNQPVQSQPKNYQRDGFMTVNGNQGGAPNYFPNSFN-GPDYLAHVPD 861 H H L PN +P N +N G NY PN N P Y+ +P+ Sbjct: 196 HMHNLPPNMHSLPPN-----------------MNYIPPGINNYMPNMMNMPPPYMMKMPN 238 Query: 862 PAKQVSQTVIPSLSSKDENN 921 K S +I ++S+ +N Sbjct: 239 -MKMKSNKIINNVSNNVADN 257 >Plasmodium_falciparum_3D7|MAL2|PFB0615c|Pf Annotation|Plasmodium_falciparum_TIGR|(protein coding) hypothetical protein Length = 2385 Score = 27.7 bits (60), Expect = 4.2 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 493 DVTKVWSHKTYPLKEVGKLVLNRNPANYFSDVEQLAFS 606 ++ K+ KTY LK+ ++ N+N NYF D E + F+ Sbjct: 1504 NMDKLNEEKTYILKDKNYIIHNKN-TNYFFDNETIIFT 1540 >Plasmodium_falciparum_3D7|MAL6|PFF0935c|Pf Annotation|Plasmodium_falciparum_Sanger|(protein coding) hypothetical protein Length = 3589 Score = 27.7 bits (60), Expect = 4.2 Identities = 10/51 (19%), Positives = 27/51 (52%) Frame = +1 Query: 406 KEYPTWTLYIQVMTQAQAEQHLAQGFNPFDVTKVWSHKTYPLKEVGKLVLN 558 K+Y +Y+++M Q E H+ ++++ +W +K+ + ++ +N Sbjct: 2624 KKYLNLVIYMKLMKQKFKENHIFNKIMKYNISSIWLNKSQIYLQYIQITIN 2674 >Plasmodium_falciparum_3D7|MAL12|PFL1715w|Pf Annotation|Plasmodium_falciparum_Stanford|(protein coding) hypothetical protein Length = 646 Score = 27.3 bits (59), Expect = 5.5 Identities = 18/76 (23%), Positives = 28/76 (36%) Frame = +1 Query: 727 NQPVQSQPKNYQRDGFMTVNGNQGGAPNYFPNSFNGPDYLAHVPDPAKQVSQTVIPSLSS 906 N QP N + +N N NY N+ P Y+ P + + P++ Sbjct: 52 NSSYNKQPNNLGASNYPYINKNYTSPNNYVVNNNVNPSYI-----PMNFNNVNISPNVPY 106 Query: 907 KDENNFTQAGQILPNV 954 + NN+ PNV Sbjct: 107 NNNNNYNYGA--YPNV 120 >Plasmodium_falciparum_3D7|MAL5|PFE0870w|Pf Annotation|Plasmodium_falciparum_Sanger|(protein coding) transcriptional regulator, putative Length = 1141 Score = 27.3 bits (59), Expect = 5.5 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +3 Query: 411 IPNMDAVHPSNDASSSRTTLGSRLQPV*CDQGVVAQDVPVEGS 539 I N+D + SND +S+ + S ++ CD+ + +D GS Sbjct: 96 IKNVDVLERSNDNTSNFENIKSTIESTNCDEIALLKDKDATGS 138 >Plasmodium_falciparum_3D7|MAL13|PF13_0010|Pf Annotation|Plasmodium_falciparum_Sanger|(protein coding) Gbph2 Length = 377 Score = 26.9 bits (58), Expect = 7.1 Identities = 19/79 (24%), Positives = 31/79 (39%) Frame = +3 Query: 714 TDPSESTSAEPTQELST*WFHDREWQPRRRAKXXXXXXXXXXXXXXXXXXC*ASEPNGHP 893 TDP++ TSA+P ++ W D E++ ++PN Sbjct: 180 TDPNDETSADPEGQIMKAWAADPEYRKHVNVLYQILTH---------------TDPNDET 224 Query: 894 VAQLEGRKQLHPSWANSPQ 950 A EG Q+ +WA P+ Sbjct: 225 SADPEG--QIMKAWAADPE 241 Score = 26.9 bits (58), Expect = 7.1 Identities = 19/79 (24%), Positives = 31/79 (39%) Frame = +3 Query: 714 TDPSESTSAEPTQELST*WFHDREWQPRRRAKXXXXXXXXXXXXXXXXXXC*ASEPNGHP 893 TDP++ TSA+P ++ W D E++ ++PN Sbjct: 142 TDPNDETSADPEGQIMKAWAADPEYRKHVNVLYQILTH---------------TDPNDET 186 Query: 894 VAQLEGRKQLHPSWANSPQ 950 A EG Q+ +WA P+ Sbjct: 187 SADPEG--QIMKAWAADPE 203 Score = 26.6 bits (57), Expect = 9.3 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 714 TDPSESTSAEPTQELST*WFHDREWQ 791 TDP++ TSA+P ++ W D E++ Sbjct: 332 TDPNDETSADPEGQIMKAWAADPEYR 357 >Plasmodium_falciparum_3D7|MAL10|PF10_0323|Pf Annotation|Plasmodium_falciparum_TIGR|(protein coding) hypothetical protein Length = 355 Score = 26.9 bits (58), Expect = 7.1 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 4 TEEGNWDLVGNNTP-IFFLRDPILFPSFIHTQKRNPATH 117 T E N+D + TP I + +PI+ PS+ T NP TH Sbjct: 267 TPESNFD---SKTPEIKEINEPIIVPSYYPTTGPNPNTH 302 >Plasmodium_falciparum_3D7|MAL11|PF11_0086|Pf Annotation|Plasmodium_falciparum_TIGR|(protein coding) hypothetical protein Length = 3334 Score = 26.9 bits (58), Expect = 7.1 Identities = 15/63 (23%), Positives = 27/63 (42%) Frame = +1 Query: 643 DKMLQGRLFSYSDTHRHRLGPNYQQIPVNQPVQSQPKNYQRDGFMTVNGNQGGAPNYFPN 822 DK+L+ + + T+ H NY + +N + + N R+ +N N N N Sbjct: 2936 DKILKETIDQNNRTYNHNNNMNYHENKMNNNLSNMRNNLLRNVSFNMNNNNNNNNNNNNN 2995 Query: 823 SFN 831 + N Sbjct: 2996 NNN 2998 Database: /home/amadoui/banque/plasm_falciparum Posted date: Mar 30, 2007 3:37 PM Number of letters in database: 4,065,673 Number of sequences in database: 5411 Lambda K H 0.318 0.136 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,213,623 Number of Sequences: 5411 Number of extensions: 130807 Number of successful extensions: 354 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 353 length of database: 4,065,673 effective HSP length: 93 effective length of database: 3,562,450 effective search space used: 833613300 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)