BLASTX 2.2.6 [Apr-09-2003] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QAF31c07.yg.2.3 (732 letters) Database: /db/trembl-ebi/tmp/swall 1,165,242 sequences; 374,381,506 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sptr|Q9LGY7|Q9LGY7 EST AU091748(C11808) corresponds to a region ... 97 2e-19 sptr|Q9C9Z9|Q9C9Z9 Hypothetical protein (Elongation defective 1). 91 1e-17 sptr|Q8VXD5|Q8VXD5 SDL-1 protein. 91 1e-17 sptr|O80820|O80820 At2g41450 protein. 78 9e-14 sptr|Q9M2M7|Q9M2M7 Hypothetical 49.7 kDa protein. 62 7e-09
>sptr|Q9LGY7|Q9LGY7 EST AU091748(C11808) corresponds to a region of the predicted gene. Length = 556 Score = 97.1 bits (240), Expect = 2e-19 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +2 Query: 383 LSQDARMDWIIHLDTDELIHPAGAREYSLRRLLLDVPDNVDMVIFPNYVS 532 +++DA MDWIIHLDTDELIHPAGAREYSLRRLLLDVPDNVDMVIFPNY S Sbjct: 241 MARDAGMDWIIHLDTDELIHPAGAREYSLRRLLLDVPDNVDMVIFPNYES 290 >sptr|Q9C9Z9|Q9C9Z9 Hypothetical protein (Elongation defective 1). Length = 533 Score = 91.3 bits (225), Expect = 1e-17 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +2 Query: 383 LSQDARMDWIIHLDTDELIHPAGAREYSLRRLLLDVPDNVDMVIFPNYVS 532 +++DA MDWI+HLDTDELI+PAGAREYSLRRLLLDVP NVDMVIFPNY S Sbjct: 231 MARDAGMDWILHLDTDELIYPAGAREYSLRRLLLDVPPNVDMVIFPNYES 280 >sptr|Q8VXD5|Q8VXD5 SDL-1 protein. Length = 529 Score = 90.9 bits (224), Expect = 1e-17 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +2 Query: 383 LSQDARMDWIIHLDTDELIHPAGAREYSLRRLLLDVPDNVDMVIFPNYVS 532 +++D MDWIIHLDTDEL+HPAGAREYSLR+LLLDVP NVDMVIFPNY S Sbjct: 218 MARDGGMDWIIHLDTDELLHPAGAREYSLRQLLLDVPSNVDMVIFPNYES 267 >sptr|O80820|O80820 At2g41450 protein. Length = 991 Score = 78.2 bits (191), Expect = 9e-14 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = +2 Query: 383 LSQDARMDWIIHLDTDELIHPAGAREYSLRRLLLDVPDNVDMVIFPNYVS 532 +++DA MDWI+HLDTDEL+HP+G REYSLR LL DVP +VD VIF NY S Sbjct: 772 MARDAGMDWILHLDTDELVHPSGTREYSLRNLLRDVPADVDEVIFTNYES 821 >sptr|Q9M2M7|Q9M2M7 Hypothetical 49.7 kDa protein. Length = 439 Score = 62.0 bits (149), Expect = 7e-09 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +2 Query: 383 LSQDARMDWIIHLDTDELIHPAGAREYSLRRLLLDVPDNVD 505 ++QDA M+WIIHLDTDELIHP+G EYSLR+LL ++ +VD Sbjct: 194 MAQDAGMEWIIHLDTDELIHPSGTHEYSLRKLLGNISADVD 234 Database: /db/trembl-ebi/tmp/swall Posted date: Jul 11, 2003 8:27 PM Number of letters in database: 374,381,506 Number of sequences in database: 1,165,242 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 402,030,755 Number of Sequences: 1165242 Number of extensions: 7837106 Number of successful extensions: 19591 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19589 length of database: 374,381,506 effective HSP length: 119 effective length of database: 235,717,708 effective search space used: 29228995792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
S1: 41 (21.7 bits)